Hi everyone!!
Category Archives: Software
XMind – Programa para Diagramas!
![]()
Olá a todos!
Quero ver se começo aqui a deixar uma serie de posts diários com a ideia do dia! :)
Então aqui vai o primeiro!
Um programa muito bom para fazer diagramas! Super fácil de usar!
A ideia é poder organizar a informação toda por diagramas! Leituras de artigos, progresso de trabalhos, ou mesmo a tese! O diagrama apenas conterá os conceitos e a informação, para o caso duma tese ou apresentação, será apenas necessário inserir o texto depois para ligar os conceitos! ;)
Dêem uma olhadela,
O melhor de tudo é que é multi-plataforma! ;)
Deixo-vos aqui um exemplo retirado do site
http://www.xmind.net/share/_embed/alexandcordeiro/personal-control-project/
O programa permite muitas mais funções como adicionar imagens, sons, etc.
É gratuito na maioria das suas funções, outras estão apenas disponíveis na versão PRO. No entanto, para o utilizador comum, essas funções extra não farão falta! ;)
Aproveitem, divirtam-se e produzam :D
Easy Sequence Alignment with Biopython
Whether you want to do an alignment of protein or nucleotide sequences, Biopython offers a handy tool for a “quick and dirty” job: the pairwise2 module. It allows for global/local alignment, using custom-built matrices, predefined ones, or none at all, and an array of other options that truly make this a very very flexible tool.
To those concerned with speed issue, pairwise2 has some parts coded in C which will be used unless they weren’t compiled properly. So, on to the actual code. To compute an alignment between two sequences, we need only 10 lines of code.
from Bio import pairwise2 from Bio.SubsMat import MatrixInfo as matlist matrix = matlist.blosum62 gap_open = -10 gap_extend = -0.5 # Only using the first 60 aas for visualization reasons.. p53_human = "MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP" p53_mouse = "MEESQSDISLELPLSQETFSGLWKLLPPEDILPSPHCMDDLLLPQDVEEFFEGPSEALRV" alns = pairwise2.align.globalds(p53_human, p53_mouse, matrix, gap_open, gap_extend) top_aln = alns[0] aln_human, aln_mouse, score, begin, end = top_aln print aln_human+'\n'+aln_mouse MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP---- MEESQSDISLELPLSQETFSGLWKLLPPEDIL-PSP-HCMDDLLL-PQDVEEFF-EGPSEALRV # Comparing with EBI NEEDLE output MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP------ MEESQSDISLELPLSQETFSGLWKLLPPEDIL-PSP-HCMDDLLL-PQDVEEFF---EGPSEALRV